SCOPe 2.08: Domain d2b8ot1: 2b8o T:6-106

Lineage for d2b8ot1 (2b8o T:6-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (35 PDB entries)
   Uniprot P13726 33-242

8. Domain d2b8ot1: 2b8o T:6-106 [128099]
   Other proteins in same PDB: d2b8oh_, d2b8ol1, d2b8ol2, d2b8ol3
   automated match to d1uj3c1
   complexed with 0gj, ca, cl, fuc, glc, mg, na, zn

Details for d2b8ot1

PDB Entry: 2b8o, 2.8 Å

PDB Description: crystal structure of glu-gly-arg-chloromethyl ketone-factor viia/soluble tissue factor complex

PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d2b8ot1:

Sequence, based on SEQRES records:

>d2b8ot1 b.1.2.1 (T:6-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagnvestgsageplyenspeftpylet

Sequence, based on observed residues (ATOM records):

>d2b8ot1 b.1.2.1 (T:6-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagngeplyenspeftpylet

Timeline for d2b8ot1:

• d2b8ot1 first appeared in SCOP 1.73
  
• d2b8ot1 appears in SCOPe 2.07