SCOP 1.73: Domain d2b8ol2: 2b8o L:91-140

Lineage for d2b8ol2 (2b8o L:91-140)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (7 families)

5. Family g.3.11.1: EGF-type module [57197] (22 proteins)

6. Protein Factor IX (IXa) [57198] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [57200] (16 PDB entries)

8. Domain d2b8ol2: 2b8o L:91-140 [128097]
   Other proteins in same PDB: d2b8oh1, d2b8ol3, d2b8ot1, d2b8ot2
   automatically matched to d1pfxl2
   complexed with ca, cl, fuc, glc, mg, na, zn

Details for d2b8ol2

PDB Entry: 2b8o, 2.8 Å

PDB Description: crystal structure of glu-gly-arg-chloromethyl ketone-factor viia/soluble tissue factor complex

PDB Compounds: (L:) Coagulation factor VII light chain

SCOP Domain Sequences for d2b8ol2:

Sequence; same for both SEQRES and ATOM records:

>d2b8ol2 g.3.11.1 (L:91-140) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}
cvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipi

Timeline for d2b8ol2:

• d2b8ol2 is new in SCOP 1.73
  
• d2b8ol2 appears in SCOP 1.75
  
• d2b8ol2 appears in the current release, SCOPe 2.08