| Class g: Small proteins [56992] (85 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (7 families) ![]() |
| Family g.3.11.1: EGF-type module [57197] (22 proteins) |
| Protein Factor IX (IXa) [57198] (2 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [57200] (16 PDB entries) |
| Domain d2b8ol2: 2b8o L:91-140 [128097] Other proteins in same PDB: d2b8oh1, d2b8ol3, d2b8ot1, d2b8ot2 automatically matched to d1pfxl2 complexed with ca, cl, fuc, glc, mg, na, zn |
PDB Entry: 2b8o (more details), 2.8 Å
SCOP Domain Sequences for d2b8ol2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b8ol2 g.3.11.1 (L:91-140) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}
cvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipi
Timeline for d2b8ol2: