Lineage for d2b8ol2 (2b8o L:87-142)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031147Protein Coagulation factor VIIa [57201] (1 species)
  7. 3031148Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 3031262Domain d2b8ol2: 2b8o L:87-142 [128097]
    Other proteins in same PDB: d2b8oh_, d2b8ol3, d2b8ot1, d2b8ot2
    automated match to d2a2ql2
    complexed with 0gj, ca, cl, fuc, glc, mg, na, zn

Details for d2b8ol2

PDB Entry: 2b8o (more details), 2.8 Å

PDB Description: crystal structure of glu-gly-arg-chloromethyl ketone-factor viia/soluble tissue factor complex
PDB Compounds: (L:) Coagulation factor VII light chain

SCOPe Domain Sequences for d2b8ol2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b8ol2 g.3.11.1 (L:87-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile

SCOPe Domain Coordinates for d2b8ol2:

Click to download the PDB-style file with coordinates for d2b8ol2.
(The format of our PDB-style files is described here.)

Timeline for d2b8ol2: