Class g: Small proteins [56992] (90 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (7 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein Coagulation factor VIIa [57201] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57202] (35 PDB entries) Uniprot P08709 108-202 ! Uniprot P08709 107-202 |
Domain d2b8ol1: 2b8o L:46-82 [128096] Other proteins in same PDB: d2b8oh_, d2b8ol3, d2b8ot1, d2b8ot2 automatically matched to d1pfxl1 complexed with 0gj, ca, cl, fuc, glc, mg, na, zn |
PDB Entry: 2b8o (more details), 2.8 Å
SCOPe Domain Sequences for d2b8ol1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b8ol1 g.3.11.1 (L:46-82) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} dgdqcasspcqnggsckdqlqsyicfclpafegrnce
Timeline for d2b8ol1: