Class b: All beta proteins [48724] (177 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Coagulation factor VIIa [50550] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50551] (88 PDB entries) Uniprot P08709 213-466 ! Uniprot P08709 213-446 |
Domain d2b8oh_: 2b8o H: [128095] Other proteins in same PDB: d2b8ol1, d2b8ol2, d2b8ol3, d2b8ot1, d2b8ot2 automated match to d1cvwh_ complexed with 0gj, ca, cl, fuc, glc, mg, na, zn |
PDB Entry: 2b8o (more details), 2.8 Å
SCOPe Domain Sequences for d2b8oh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b8oh_ b.47.1.2 (H:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} ivggkvcpkgecpwqvlllvngaqlcggtlintiwvvsaahcfdkiknwrnliavlgehd lsehdgdeqsrrvaqviipstyvpgttnhdiallrlhqpvvltdhvvplclpertfsert lafvrfslvsgwgqlldrgatalelmvlnvprlmtqdclqqsrkvgdspniteymfcagy sdgskdsckgdsggphathyrgtwyltgivswgqgcatvghfgvytrvsqyiewlqklmr seprpgvllrapfp
Timeline for d2b8oh_: