Lineage for d2b8ma1 (2b8m A:1-108)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2080272Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2080773Family b.82.1.18: MJ0764-like [141612] (1 protein)
    automatically mapped to Pfam PF04962
  6. 2080774Protein Hypothetical protein MJ0764 [141613] (1 species)
  7. 2080775Species Methanococcus jannaschii [TaxId:2190] [141614] (1 PDB entry)
    Uniprot Q58174 1-108
  8. 2080776Domain d2b8ma1: 2b8m A:1-108 [128092]
    Other proteins in same PDB: d2b8ma2
    complexed with cl, edo, so4

Details for d2b8ma1

PDB Entry: 2b8m (more details), 1.7 Å

PDB Description: Crystal structure of a rmlc-like cupin family protein with a double-stranded beta-helix fold (mj0764) from methanocaldococcus jannaschii at 1.70 A resolution
PDB Compounds: (A:) Hypothetical protein MJ0764

SCOPe Domain Sequences for d2b8ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Methanococcus jannaschii [TaxId: 2190]}
miekvyefkrdaktkvveklvntehvqinhivlprgeqmpkhysnsyvhliiikgemtlt
ledqephnykegnivyvpfnvkmliqninsdileffvvkaphpkklna

SCOPe Domain Coordinates for d2b8ma1:

Click to download the PDB-style file with coordinates for d2b8ma1.
(The format of our PDB-style files is described here.)

Timeline for d2b8ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2b8ma2