Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.18: MJ0764-like [141612] (1 protein) automatically mapped to Pfam PF04962 |
Protein Hypothetical protein MJ0764 [141613] (1 species) |
Species Methanococcus jannaschii [TaxId:2190] [141614] (1 PDB entry) Uniprot Q58174 1-108 |
Domain d2b8ma1: 2b8m A:1-108 [128092] Other proteins in same PDB: d2b8ma2 complexed with cl, edo, so4 |
PDB Entry: 2b8m (more details), 1.7 Å
SCOPe Domain Sequences for d2b8ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Methanococcus jannaschii [TaxId: 2190]} miekvyefkrdaktkvveklvntehvqinhivlprgeqmpkhysnsyvhliiikgemtlt ledqephnykegnivyvpfnvkmliqninsdileffvvkaphpkklna
Timeline for d2b8ma1: