SCOPe 2.08: Domain d2b8ma1: 2b8m A:1-108

Lineage for d2b8ma1 (2b8m A:1-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.18: MJ0764-like [141612] (1 protein)
   automatically mapped to Pfam PF04962

6. Protein Hypothetical protein MJ0764 [141613] (1 species)

7. Species Methanococcus jannaschii [TaxId:2190] [141614] (1 PDB entry)
   Uniprot Q58174 1-108

8. Domain d2b8ma1: 2b8m A:1-108 [128092]
   Other proteins in same PDB: d2b8ma2
   complexed with cl, edo, so4

Details for d2b8ma1

PDB Entry: 2b8m, 1.7 Å

PDB Description: Crystal structure of a rmlc-like cupin family protein with a double-stranded beta-helix fold (mj0764) from methanocaldococcus jannaschii at 1.70 A resolution

PDB Compounds: (A:) Hypothetical protein MJ0764

SCOPe Domain Sequences for d2b8ma1:

Sequence; same for both SEQRES and ATOM records:

>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Methanococcus jannaschii [TaxId: 2190]}
miekvyefkrdaktkvveklvntehvqinhivlprgeqmpkhysnsyvhliiikgemtlt
ledqephnykegnivyvpfnvkmliqninsdileffvvkaphpkklna

Timeline for d2b8ma1:

• d2b8ma1 first appeared in SCOP 1.73
  
• d2b8ma1 appears in SCOPe 2.07