![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
![]() | Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) ![]() form homo and heterodimers |
![]() | Family d.74.3.2: RBP11/RpoL [64311] (4 proteins) |
![]() | Protein RPB11 [64312] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64313] (23 PDB entries) Uniprot P38902; part of multichain biological unit |
![]() | Domain d2b8kk1: 2b8k K:1-114 [128090] Other proteins in same PDB: d2b8ka1, d2b8kb1, d2b8kc1, d2b8kc2, d2b8kd1, d2b8ke1, d2b8ke2, d2b8kf1, d2b8kg1, d2b8kg2, d2b8kh1, d2b8ki1, d2b8ki2, d2b8kj1, d2b8kl1 automatically matched to d1i3qk_ complexed with zn |
PDB Entry: 2b8k (more details), 4.15 Å
SCOPe Domain Sequences for d2b8kk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b8kk1 d.74.3.2 (K:1-114) RPB11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl
Timeline for d2b8kk1: