Lineage for d2b8ki1 (2b8k I:2-49)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 750747Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families) (S)
  5. 750748Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins)
  6. 750749Protein RBP9 subunit of RNA polymerase II [57787] (2 species)
    contains two differently decorated domains of this fold
  7. 750752Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries)
  8. 750789Domain d2b8ki1: 2b8k I:2-49 [128087]
    Other proteins in same PDB: d2b8ka1, d2b8kb1, d2b8kc1, d2b8kc2, d2b8kd1, d2b8ke1, d2b8ke2, d2b8kf1, d2b8kg1, d2b8kg2, d2b8kh1, d2b8kj1, d2b8kk1, d2b8kl1
    automatically matched to d1i3qi1
    complexed with zn

Details for d2b8ki1

PDB Entry: 2b8k (more details), 4.15 Å

PDB Description: 12-subunit RNA Polymerase II
PDB Compounds: (I:) DNA-directed RNA polymerase II subunit 9

SCOP Domain Sequences for d2b8ki1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b8ki1 g.41.3.1 (I:2-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli

SCOP Domain Coordinates for d2b8ki1:

Click to download the PDB-style file with coordinates for d2b8ki1.
(The format of our PDB-style files is described here.)

Timeline for d2b8ki1: