Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.230: Dodecin subunit-like [88797] (6 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
Superfamily d.230.1: N-terminal, heterodimerisation domain of RBP7 (RpoE) [88798] (1 family) |
Family d.230.1.1: N-terminal, heterodimerisation domain of RBP7 (RpoE) [88799] (1 protein) |
Protein N-terminal, heterodimerisation domain of RBP7 (RpoE) [88800] (3 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117777] (6 PDB entries) Uniprot P34087 |
Domain d2b8kg2: 2b8k G:1-80 [128085] Other proteins in same PDB: d2b8ka1, d2b8kb1, d2b8kc1, d2b8kc2, d2b8kd1, d2b8ke1, d2b8ke2, d2b8kf1, d2b8kg1, d2b8kh1, d2b8ki1, d2b8ki2, d2b8kj1, d2b8kk1, d2b8kl1 automatically matched to d1y14b2 complexed with zn |
PDB Entry: 2b8k (more details), 4.15 Å
SCOPe Domain Sequences for d2b8kg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b8kg2 d.230.1.1 (G:1-80) N-terminal, heterodimerisation domain of RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mffikdlslnitlhpsffgprmkqylktklleevegsctgkfgyilcvldydnidiqrgr ilptdgsaefnvkyravvfk
Timeline for d2b8kg2: