SCOPe 2.06: Domain d2b8kg1: 2b8k G:81-171

Lineage for d2b8kg1 (2b8k G:81-171)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) [88670] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117195] (6 PDB entries)
   Uniprot P34087

8. Domain d2b8kg1: 2b8k G:81-171 [128084]
   Other proteins in same PDB: d2b8ka1, d2b8kb1, d2b8kc1, d2b8kc2, d2b8kd1, d2b8ke1, d2b8ke2, d2b8kf1, d2b8kg2, d2b8kh1, d2b8ki1, d2b8ki2, d2b8kj1, d2b8kk1, d2b8kl1
   automatically matched to d1y14b1
   complexed with zn

Details for d2b8kg1

PDB Entry: 2b8k, 4.15 Å

PDB Description: 12-subunit RNA Polymerase II

PDB Compounds: (G:) DNA-directed RNA polymerase II 19 kDa polypeptide

SCOPe Domain Sequences for d2b8kg1:

Sequence; same for both SEQRES and ATOM records:

>d2b8kg1 b.40.4.5 (G:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pfkgevvdgtvvscsqhgfevqvgpmkvfvtkhlmpqdltfnagsnppsyqssedvitik
srirvkiegcisqvssihaigsikedylgai

Timeline for d2b8kg1:

• d2b8kg1 first appeared in SCOP 1.73
  
• d2b8kg1 appears in SCOPe 2.05
  
• d2b8kg1 appears in SCOPe 2.07
  
• d2b8kg1 appears in the current release, SCOPe 2.08