| Class b: All beta proteins [48724] (174 folds) |
| Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) ![]() |
| Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins) barrel, closed; n=5, S=8 |
| Protein C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) [88670] (3 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117195] (6 PDB entries) Uniprot P34087 |
| Domain d2b8kg1: 2b8k G:81-171 [128084] Other proteins in same PDB: d2b8ka1, d2b8kb1, d2b8kc1, d2b8kc2, d2b8kd1, d2b8ke1, d2b8ke2, d2b8kf1, d2b8kg2, d2b8kh1, d2b8ki1, d2b8ki2, d2b8kj1, d2b8kk1, d2b8kl1 automatically matched to d1y14b1 complexed with zn |
PDB Entry: 2b8k (more details), 4.15 Å
SCOPe Domain Sequences for d2b8kg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b8kg1 b.40.4.5 (G:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pfkgevvdgtvvscsqhgfevqvgpmkvfvtkhlmpqdltfnagsnppsyqssedvitik
srirvkiegcisqvssihaigsikedylgai
Timeline for d2b8kg1: