Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily) core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families) automatically mapped to Pfam PF01191 |
Family d.78.1.1: RPB5 [55288] (2 proteins) |
Protein Eukaryotic RPB5 C-terminal domain [55292] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (26 PDB entries) Uniprot P20434; part of multichain biological unit |
Domain d2b8ke2: 2b8k E:144-215 [128082] Other proteins in same PDB: d2b8ka1, d2b8kb1, d2b8kc1, d2b8kc2, d2b8kd1, d2b8ke1, d2b8kf1, d2b8kg1, d2b8kg2, d2b8kh1, d2b8ki1, d2b8ki2, d2b8kj1, d2b8kk1, d2b8kl1 automatically matched to d1dzfa2 complexed with zn |
PDB Entry: 2b8k (more details), 4.15 Å
SCOPe Domain Sequences for d2b8ke2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b8ke2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse tsgryasyricm
Timeline for d2b8ke2: