Lineage for d2b8kc2 (2b8k C:42-172)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1684390Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 1684391Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
    automatically mapped to Pfam PF01000
  5. 1684392Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 1684463Protein RPB3 [64462] (2 species)
  7. 1684464Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64463] (24 PDB entries)
    Uniprot P16370; part of multichain biological unit
  8. 1684489Domain d2b8kc2: 2b8k C:42-172 [128079]
    Other proteins in same PDB: d2b8ka1, d2b8kb1, d2b8kc1, d2b8kd1, d2b8ke1, d2b8ke2, d2b8kf1, d2b8kg1, d2b8kg2, d2b8kh1, d2b8ki1, d2b8ki2, d2b8kj1, d2b8kk1, d2b8kl1
    automatically matched to d1i3qc2
    complexed with zn

Details for d2b8kc2

PDB Entry: 2b8k (more details), 4.15 Å

PDB Description: 12-subunit RNA Polymerase II
PDB Compounds: (C:) DNA-directed RNA polymerase II 45 kDa polypeptide

SCOPe Domain Sequences for d2b8kc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b8kc2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl
qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk
giakehakwgp

SCOPe Domain Coordinates for d2b8kc2:

Click to download the PDB-style file with coordinates for d2b8kc2.
(The format of our PDB-style files is described here.)

Timeline for d2b8kc2: