SCOPe 2.08: Domain d2b8jb_: 2b8j B:

Lineage for d2b8jb_ (2b8j B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein)
   the insertion subdomain is a helical hairpin
   automatically mapped to Pfam PF03767

6. Protein Class B acid phosphatase, AphA [102308] (2 species)

7. Species Escherichia coli [TaxId:562] [102309] (13 PDB entries)
   Uniprot P32697 27-237

8. Domain d2b8jb_: 2b8j B: [128075]
   automated match to d1rm7a_
   complexed with adn, au, au3, mg, po4, spm

Details for d2b8jb_

PDB Entry: 2b8j, 2.03 Å

PDB Description: Crystal structure of AphA class B acid phosphatase/phosphotransferase ternary complex with adenosine and phosphate at 2 A resolution

PDB Compounds: (B:) Class B acid phosphatase

SCOPe Domain Sequences for d2b8jb_:

Sequence; same for both SEQRES and ATOM records:

>d2b8jb_ c.108.1.12 (B:) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]}
spsplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkk
tfspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktet
vsktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgar
girilrasnstykplpqagafgeevivnsey

Timeline for d2b8jb_:

• d2b8jb_ first appeared in SCOP 1.73, called d2b8jb1
  
• d2b8jb_ appears in SCOPe 2.07