Lineage for d2b8ec1 (2b8e C:416-434,C:548-663)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712195Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 712196Superfamily c.108.1: HAD-like [56784] (23 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 712343Family c.108.1.7: Meta-cation ATPase, catalytic domain P [81656] (2 proteins)
    interrupted by a large insertion, domain N
  6. 712360Protein Cation-transporting ATPase [142175] (1 species)
  7. 712361Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [142176] (1 PDB entry)
  8. 712364Domain d2b8ec1: 2b8e C:416-434,C:548-663 [128072]
    Other proteins in same PDB: d2b8ea2, d2b8eb2, d2b8ec2
    automatically matched to 2B8E A:416-434,A:548-663

Details for d2b8ec1

PDB Entry: 2b8e (more details), 2.3 Å

PDB Description: CopA ATP Binding Domain
PDB Compounds: (C:) cation-transporting ATPase

SCOP Domain Sequences for d2b8ec1:

Sequence, based on SEQRES records: (download)

>d2b8ec1 c.108.1.7 (C:416-434,C:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
ekvtavifdktgtltkgkpXdtlkesakpavqelkrmgikvgmitgdnwrsaeaisreln
ldlviaevlphqkseevkklqakevvafvgdgindapalaqadlgiavgsgsdvavesgd
ivlirddlrdvvaaiq

Sequence, based on observed residues (ATOM records): (download)

>d2b8ec1 c.108.1.7 (C:416-434,C:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
ekvtavifdktgtltkgkpXdtlkesakpavqelkrmgikvgmitgdnwrsaeaisreln
ldlviaevlphqkseevkklqakevvafvgdgindapalaqadlgiavgsgsgdivlird
dlrdvvaaiq

SCOP Domain Coordinates for d2b8ec1:

Click to download the PDB-style file with coordinates for d2b8ec1.
(The format of our PDB-style files is described here.)

Timeline for d2b8ec1: