Lineage for d2b8eb1 (2b8e B:415-434,B:548-665)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526731Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2526732Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2527060Family c.108.1.7: Meta-cation ATPase, catalytic domain P [81656] (3 proteins)
    interrupted by a large insertion, domain N
  6. 2527116Protein Cation-transporting ATPase [142175] (1 species)
  7. 2527117Species Archaeoglobus fulgidus [TaxId:2234] [142176] (1 PDB entry)
    Uniprot O29777 416-434,548-663
  8. 2527119Domain d2b8eb1: 2b8e B:415-434,B:548-665 [128070]
    Other proteins in same PDB: d2b8ea2, d2b8eb2, d2b8ec2
    automated match to d2b8ea1

Details for d2b8eb1

PDB Entry: 2b8e (more details), 2.3 Å

PDB Description: CopA ATP Binding Domain
PDB Compounds: (B:) cation-transporting ATPase

SCOPe Domain Sequences for d2b8eb1:

Sequence, based on SEQRES records: (download)

>d2b8eb1 c.108.1.7 (B:415-434,B:548-665) Cation-transporting ATPase {Archaeoglobus fulgidus [TaxId: 2234]}
aekvtavifdktgtltkgkpXdtlkesakpavqelkrmgikvgmitgdnwrsaeaisrel
nldlviaevlphqkseevkklqakevvafvgdgindapalaqadlgiavgsgsdvavesg
divlirddlrdvvaaiqls

Sequence, based on observed residues (ATOM records): (download)

>d2b8eb1 c.108.1.7 (B:415-434,B:548-665) Cation-transporting ATPase {Archaeoglobus fulgidus [TaxId: 2234]}
aekvtavifdktgtltkgkpXdtlkesakpavqelkrmgikvgmitgdnwrsaeaisrel
nldlviaevlphqkseevkklqakevvafvgdgindapalaqadlgiavgdivlirddlr
dvvaaiqls

SCOPe Domain Coordinates for d2b8eb1:

Click to download the PDB-style file with coordinates for d2b8eb1.
(The format of our PDB-style files is described here.)

Timeline for d2b8eb1: