SCOPe 2.05: Domain d2b8eb1: 2b8e B:415-434,B:548-665

Lineage for d2b8eb1 (2b8e B:415-434,B:548-665)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.7: Meta-cation ATPase, catalytic domain P [81656] (2 proteins)
   interrupted by a large insertion, domain N

6. Protein Cation-transporting ATPase [142175] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [142176] (1 PDB entry)
   Uniprot O29777 416-434,548-663

8. Domain d2b8eb1: 2b8e B:415-434,B:548-665 [128070]
   Other proteins in same PDB: d2b8ea2, d2b8eb2, d2b8ec2
   automated match to d2b8ea1

Details for d2b8eb1

PDB Entry: 2b8e, 2.3 Å

PDB Description: CopA ATP Binding Domain

PDB Compounds: (B:) cation-transporting ATPase

SCOPe Domain Sequences for d2b8eb1:

Sequence, based on SEQRES records:

>d2b8eb1 c.108.1.7 (B:415-434,B:548-665) Cation-transporting ATPase {Archaeoglobus fulgidus [TaxId: 2234]}
aekvtavifdktgtltkgkpXdtlkesakpavqelkrmgikvgmitgdnwrsaeaisrel
nldlviaevlphqkseevkklqakevvafvgdgindapalaqadlgiavgsgsdvavesg
divlirddlrdvvaaiqls

Sequence, based on observed residues (ATOM records):

>d2b8eb1 c.108.1.7 (B:415-434,B:548-665) Cation-transporting ATPase {Archaeoglobus fulgidus [TaxId: 2234]}
aekvtavifdktgtltkgkpXdtlkesakpavqelkrmgikvgmitgdnwrsaeaisrel
nldlviaevlphqkseevkklqakevvafvgdgindapalaqadlgiavgdivlirddlr
dvvaaiqls

Timeline for d2b8eb1:

• d2b8eb1 first appeared in SCOP 1.73
  
• d2b8eb1 appears in SCOPe 2.04
  
• d2b8eb1 appears in SCOPe 2.06
  
• d2b8eb1 appears in the current release, SCOPe 2.08