![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
![]() | Superfamily b.35.1: GroES-like [50129] (2 families) ![]() |
![]() | Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins) C-terminal domain is alpha/beta (classical Rossmann-fold) |
![]() | Protein Bacterial secondary alcohol dehydrogenase [50142] (2 species) |
![]() | Species Thermoanaerobacter brockii [TaxId:29323] [50144] (4 PDB entries) |
![]() | Domain d2b83d1: 2b83 D:1-139,D:314-351 [128065] Other proteins in same PDB: d2b83a2, d2b83b2, d2b83c2, d2b83d2 automatically matched to d1bxza1 complexed with zn; mutant |
PDB Entry: 2b83 (more details), 2.25 Å
SCOP Domain Sequences for d2b83d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b83d1 b.35.1.2 (D:1-139,D:314-351) Bacterial secondary alcohol dehydrogenase {Thermoanaerobacter brockii [TaxId: 29323]} mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfpqhsngmlagwkfsnfkdgvf geyfhvndadmnlailpkdXvdlsklvthvyhgfdhieealllmkdkpkdlikavvil
Timeline for d2b83d1: