Lineage for d2b83d1 (2b83 D:1-139,D:314-351)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666133Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 666134Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 666255Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 protein domains)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 666454Protein Bacterial secondary alcohol dehydrogenase [50142] (2 species)
  7. 666468Species Thermoanaerobacter brockii [TaxId:29323] [50144] (3 PDB entries)
  8. 666472Domain d2b83d1: 2b83 D:1-139,D:314-351 [128065]
    Other proteins in same PDB: d2b83a2, d2b83b2, d2b83c2, d2b83d2
    automatically matched to d1bxza1
    complexed with zn; mutant

Details for d2b83d1

PDB Entry: 2b83 (more details), 2.25 Å

PDB Description: A single amino acid substitution in the Clostridium beijerinckii alcohol dehydrogenase is critical for thermostabilization
PDB Compounds: (D:) NADP-dependent alcohol dehydrogenase

SCOP Domain Sequences for d2b83d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b83d1 b.35.1.2 (D:1-139,D:314-351) Bacterial secondary alcohol dehydrogenase {Thermoanaerobacter brockii [TaxId: 29323]}
mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfpqhsngmlagwkfsnfkdgvf
geyfhvndadmnlailpkdXvdlsklvthvyhgfdhieealllmkdkpkdlikavvil

SCOP Domain Coordinates for d2b83d1:

Click to download the PDB-style file with coordinates for d2b83d1.
(The format of our PDB-style files is described here.)

Timeline for d2b83d1: