SCOPe 2.05: Domain d2b83c2: 2b83 C:140-313

Lineage for d2b83c2 (2b83 C:140-313)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 proteins)
   N-terminal all-beta domain defines family

6. Protein Bacterial secondary alcohol dehydrogenase [51742] (2 species)

7. Species Clostridium beijerinckii [TaxId:1520] [51743] (4 PDB entries)

8. Domain d2b83c2: 2b83 C:140-313 [128064]
   Other proteins in same PDB: d2b83a1, d2b83b1, d2b83c1, d2b83d1
   automatically matched to d1bxza2
   complexed with zn

Details for d2b83c2

PDB Entry: 2b83, 2.25 Å

PDB Description: a single amino acid substitution in the clostridium beijerinckii alcohol dehydrogenase is critical for thermostabilization

PDB Compounds: (C:) NADP-dependent alcohol dehydrogenase

SCOPe Domain Sequences for d2b83c2:

Sequence; same for both SEQRES and ATOM records:

>d2b83c2 c.2.1.1 (C:140-313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]}
mplenavmitdmmttgfhgaeladiqmgssvvvigigavglmgiagaklrgagriigvgs
rpicveaakfygatdilnyknghivdqvmkltngkgvdrvimagggsetlsqavsmvkpg
giisninyhgsgdalliprvewgcgmahktikgglcpggrlraemlrdmvvynr

Timeline for d2b83c2:

• d2b83c2 first appeared in SCOP 1.73
  
• d2b83c2 appears in SCOPe 2.04
  
• d2b83c2 appears in SCOPe 2.06
  
• d2b83c2 appears in the current release, SCOPe 2.08