| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
| Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein) the insertion subdomain is a helical hairpin |
| Protein Class B acid phosphatase, AphA [102308] (2 species) |
| Species Escherichia coli [TaxId:562] [102309] (11 PDB entries) Uniprot P32697 27-237 |
| Domain d2b82b_: 2b82 B: [128058] automated match to d1rm7a_ complexed with adn, mg, po4 |
PDB Entry: 2b82 (more details), 1.25 Å
SCOPe Domain Sequences for d2b82b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b82b_ c.108.1.12 (B:) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]}
spsplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkk
tfspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktet
vsktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgar
girilrasnstykplpqagafgeevivnsey
Timeline for d2b82b_: