Lineage for d2b82b1 (2b82 B:4-212)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712195Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 712196Superfamily c.108.1: HAD-like [56784] (23 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 712479Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein)
    the insertion subdomain is a helical hairpin
  6. 712480Protein Class B acid phosphatase, AphA [102308] (2 species)
  7. 712481Species Escherichia coli [TaxId:562] [102309] (8 PDB entries)
  8. 712483Domain d2b82b1: 2b82 B:4-212 [128058]
    automatically matched to d1n8na_
    complexed with adn, mg, po4

Details for d2b82b1

PDB Entry: 2b82 (more details), 1.25 Å

PDB Description: Crystal structure of AphA class B acid phosphatase/phosphotransferase ternary complex with adenosine and phosphate bound to the catalytic metal at 1.2 A resolution
PDB Compounds: (B:) Class B acid phosphatase

SCOP Domain Sequences for d2b82b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b82b1 c.108.1.12 (B:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]}
splnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkktf
spesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktetvs
ktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgargi
rilrasnstykplpqagafgeevivnsey

SCOP Domain Coordinates for d2b82b1:

Click to download the PDB-style file with coordinates for d2b82b1.
(The format of our PDB-style files is described here.)

Timeline for d2b82b1: