SCOP 1.75: Domain d2b82a1: 2b82 A:4-212

Lineage for d2b82a1 (2b82 A:4-212)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (25 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein)
   the insertion subdomain is a helical hairpin

6. Protein Class B acid phosphatase, AphA [102308] (2 species)

7. Species Escherichia coli [TaxId:562] [102309] (10 PDB entries)
   Uniprot P32697 27-237

8. Domain d2b82a1: 2b82 A:4-212 [128057]
   automatically matched to d1n8na_
   complexed with adn, mg, po4

Details for d2b82a1

PDB Entry: 2b82, 1.25 Å

PDB Description: Crystal structure of AphA class B acid phosphatase/phosphotransferase ternary complex with adenosine and phosphate bound to the catalytic metal at 1.2 A resolution

PDB Compounds: (A:) Class B acid phosphatase

SCOP Domain Sequences for d2b82a1:

Sequence; same for both SEQRES and ATOM records:

>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]}
splnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkktf
spesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktetvs
ktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgargi
rilrasnstykplpqagafgeevivnsey

Timeline for d2b82a1:

• d2b82a1 first appeared in SCOP 1.73
  
• d2b82a1 is called d2b82a_ in SCOPe 2.01
  
• d2b82a1 appears in the current release, SCOPe 2.08, called d2b82a_