Lineage for d2b7ta1 (2b7t A:1-73)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946839Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2946840Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 2946841Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
    Pfam PF00035
  6. 2946860Protein dsRNA-specific editase 1 [143202] (1 species)
    duplication: contains two dsRBD domains
  7. 2946861Species Norway rat (Rattus norvegicus) [TaxId:10116] [143203] (3 PDB entries)
    Uniprot P51400 231-301! Uniprot P51400 74-146
  8. 2946863Domain d2b7ta1: 2b7t A:1-73 [128055]
    1st dsRBD

Details for d2b7ta1

PDB Entry: 2b7t (more details)

PDB Description: structure of adar2 dsrbm1
PDB Compounds: (A:) Double-stranded RNA-specific editase 1

SCOPe Domain Sequences for d2b7ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b7ta1 d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pgpvlpknalmqlneikpglqymllsqtgpvhaplfvmsvevngqvfegsgptkkkaklh
aaekalrsfvqfp

SCOPe Domain Coordinates for d2b7ta1:

Click to download the PDB-style file with coordinates for d2b7ta1.
(The format of our PDB-style files is described here.)

Timeline for d2b7ta1: