Lineage for d2b7sa2 (2b7s A:111-361,A:512-568)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2457625Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2457626Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2458096Family c.3.1.4: Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain [51934] (5 proteins)
  6. 2458103Protein Flavocytochrome c3 (respiratory fumarate reductase) [51940] (2 species)
    contains additional N-terminal multiheme domain
  7. 2458104Species Shewanella frigidimarina [TaxId:56812] [51941] (16 PDB entries)
  8. 2458113Domain d2b7sa2: 2b7s A:111-361,A:512-568 [128053]
    Other proteins in same PDB: d2b7sa1, d2b7sa3
    automatically matched to d1qo8a2
    complexed with fad, fum, hem, na; mutant

Details for d2b7sa2

PDB Entry: 2b7s (more details), 2.12 Å

PDB Description: r381k mutant of flavocytochrome c3
PDB Compounds: (A:) Fumarate reductase flavoprotein subunit

SCOPe Domain Sequences for d2b7sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b7sa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]}
dkserqaalasaphdtvdvvvvgsggagfsaaisatdsgakviliekepviggnaklaag
gmnaawtdqqkakkitdspelmfedtmkggqnindpalvkvlsshskdsvdwmtamgadl
tdvgmmggasvnrahrptggagvgahvvqvlydnavkrnidlrmntrgievlkddkgtvk
gilvkgmykgyywvkadavilatggfaknnervakldpslkgfistnqpgavgdgldvae
naggalkdmqyXidtkaevmnakkqvipglygagevtggvhganrlggnaisdiitfgrl
ageeaakys

SCOPe Domain Coordinates for d2b7sa2:

Click to download the PDB-style file with coordinates for d2b7sa2.
(The format of our PDB-style files is described here.)

Timeline for d2b7sa2: