SCOP 1.73: Domain d2b7ra1: 2b7r A:1-102

Lineage for d2b7ra1 (2b7r A:1-102)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (3 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.3: Di-heme elbow motif [48711] (7 proteins)
   the main characteristic feature of this motif is the packing of its two hemes
   many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

6. Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (3 species)

7. Species Shewanella frigidimarina [TaxId:56812] [48722] (16 PDB entries)

8. Domain d2b7ra1: 2b7r A:1-102 [128049]
   Other proteins in same PDB: d2b7ra2, d2b7ra3
   automatically matched to d1e39a1
   complexed with fad, fum, hem, na; mutant

Details for d2b7ra1

PDB Entry: 2b7r, 1.7 Å

PDB Description: structure of e378d mutant flavocytochrome c3

PDB Compounds: (A:) Fumarate reductase flavoprotein subunit

SCOP Domain Sequences for d2b7ra1:

Sequence; same for both SEQRES and ATOM records:

>d2b7ra1 a.138.1.3 (A:1-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella frigidimarina [TaxId: 56812]}
adnlaefhvqnqecdschtpdgelsndsltyentqcvschgtlaevaettkhehynahas
hfpgevactschsaheksmvycdschsfdfnmpyakkwlrde

Timeline for d2b7ra1:

• d2b7ra1 is new in SCOP 1.73
  
• d2b7ra1 appears in SCOP 1.75
  
• d2b7ra1 appears in the current release, SCOPe 2.08