| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) ![]() duplication: contains multiple CxxCH motifs |
| Family a.138.1.3: Di-heme elbow motif [48711] (7 proteins) the main characteristic feature of this motif is the packing of its two hemes many members contains one or more complete motifs flanked by incomplete motifs and/or other domains |
| Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (3 species) |
| Species Shewanella frigidimarina [TaxId:56812] [48722] (16 PDB entries) |
| Domain d2b7ra1: 2b7r A:1-102 [128049] Other proteins in same PDB: d2b7ra2, d2b7ra3 automatically matched to d1e39a1 complexed with fad, fum, hem, na; mutant |
PDB Entry: 2b7r (more details), 1.7 Å
SCOP Domain Sequences for d2b7ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b7ra1 a.138.1.3 (A:1-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella frigidimarina [TaxId: 56812]}
adnlaefhvqnqecdschtpdgelsndsltyentqcvschgtlaevaettkhehynahas
hfpgevactschsaheksmvycdschsfdfnmpyakkwlrde
Timeline for d2b7ra1: