Lineage for d2b7ob_ (2b7o B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 972170Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 973177Family c.1.10.8: Class-II DAHP synthetase [141840] (2 proteins)
    Pfam PF01474
  6. 973178Protein Probable DAHP synthetase AroG, phenylalanine-repressible [141841] (1 species)
  7. 973179Species Mycobacterium tuberculosis [TaxId:1773] [141842] (4 PDB entries)
    Uniprot O53512 1-462
  8. 973185Domain d2b7ob_: 2b7o B: [128048]
    automated match to d2b7oa1
    complexed with ce1, mn, pep, so4

Details for d2b7ob_

PDB Entry: 2b7o (more details), 2.3 Å

PDB Description: The Structure of 3-Deoxy-D-Arabino-Heptulosonate 7-Phosphate Synthase from Mycobacterium tuberculosis
PDB Compounds: (B:) 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase arog

SCOPe Domain Sequences for d2b7ob_:

Sequence, based on SEQRES records: (download)

>d2b7ob_ c.1.10.8 (B:) Probable DAHP synthetase AroG, phenylalanine-repressible {Mycobacterium tuberculosis [TaxId: 1773]}
gamnwtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppv
tvpseivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygas
mpvvkvariagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasa
amnlvraltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnl
qtaeiyashealvldyeramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqv
ianpvgvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatg
hqviwqcdpmhgnthesstgfktrhfdrivdevqgffevhralgthpggihveitgenvt
eclggaqdisetdlagryetacdprlntqqslelaflvaemlrd

Sequence, based on observed residues (ATOM records): (download)

>d2b7ob_ c.1.10.8 (B:) Probable DAHP synthetase AroG, phenylalanine-repressible {Mycobacterium tuberculosis [TaxId: 1773]}
gamnwtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppv
tvpseivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygas
mpvvkvariagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasa
amnlvraltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnl
qtaeiyashealvldyeramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqv
ianpvgvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatg
hqviwqcdpmhgnthesfktrhfdrivdevqgffevhralgthpggihveitgenvtecl
lagryetacdprlntqqslelaflvaemlrd

SCOPe Domain Coordinates for d2b7ob_:

Click to download the PDB-style file with coordinates for d2b7ob_.
(The format of our PDB-style files is described here.)

Timeline for d2b7ob_: