Lineage for d2b7ma1 (2b7m A:73-623)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007926Superfamily a.118.17: Cullin repeat-like [74788] (3 families) (S)
  5. 2007936Family a.118.17.2: Exocyst complex component [140851] (3 protein domains)
    includes Pfam PF03081
  6. 2007937Protein Exocyst complex component EXO70 [140854] (1 species)
  7. 2007938Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140855] (2 PDB entries)
    Uniprot P19658 73-623
  8. 2007940Domain d2b7ma1: 2b7m A:73-623 [128046]

Details for d2b7ma1

PDB Entry: 2b7m (more details), 3.5 Å

PDB Description: Crystal Structure of the S. cerevisiae Exocyst Component Exo70p
PDB Compounds: (A:) Exocyst complex component EXO70

SCOPe Domain Sequences for d2b7ma1:

Sequence, based on SEQRES records: (download)

>d2b7ma1 a.118.17.2 (A:73-623) Exocyst complex component EXO70 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
svkdlaneaskyeiilqkginqvglkqytqvvhklddmlediqsgqanreensefhgilt
hleqlikrseaqlrvyfisilnsikpfdpqinitkkmpfpyyedqqlgalswildyfhgn
segsiiqdilvgersklilkcmaflepfakeistaknapyekgssgmnsyteallgfian
ekslvddlysqyteskphvlsqilsplisayaklfganlkivrsnlenfgffsfelvesi
ndvkkslrgkelqnynllqdctqevrqvtqslfrdaidriikkansistipsnngvteat
vdtmsrlrkfseykngclgamdnitrenwlpsnykekeytlqnealnwedhnvllscfis
dcidtlavnlerkaqialmpnqepdvanpnssknkhkqrigffilmnltlveqiveksel
nlmlageghsrlerlkkryisymvsdwrdltanlmdsvfidssgkkskdkeqikekfrkf
negfedlvsktkqyklsdpslkvtlkseiislvmpmyerfysrykdsfknprkhikytpd
elttvlnqlvr

Sequence, based on observed residues (ATOM records): (download)

>d2b7ma1 a.118.17.2 (A:73-623) Exocyst complex component EXO70 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
svkdlaneaskyeiilqkginqvglkqytqvvhklddmlediqsgqanreensefhgilt
hleqlikrseaqlrvyfisilnsikpfdpqinitkkmpfpyyedqqlgalswildyfhgn
segsiiqdilvgersklilkcmaflepfakessgmnsyteallgfianekslvddlysqy
teskphvlsqilsplisayaklfganlkivrsnlenfgffsfelvesindvkkslrgkel
qnynllqdctqevrqvtqslfrdaidriikkansistipsnngvteatvdtmsrlrkfse
ykngclgamdnitrenwlpsnykekeytlqnealnwedhnvllscfisdcidtlavnler
kaqialmpnqepdvanpnssknkhkqrigffilmnltlveqivekselnlmlageghsrl
erlkkryisymvsdwrdltanlmegfedlvsktkqyklsdpslkvtlkseiislvmpmye
rfysrykdsfknprkhikytpdelttvlnqlvr

SCOPe Domain Coordinates for d2b7ma1:

Click to download the PDB-style file with coordinates for d2b7ma1.
(The format of our PDB-style files is described here.)

Timeline for d2b7ma1: