Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (22 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins) |
Protein Thioredoxin-like protein Sco1 (YpmQ), soluble domain [102459] (3 species) |
Species Baker's yeast(Saccharomyces cerevisiae) [TaxId:4932] [142372] (2 PDB entries) |
Domain d2b7kd1: 2b7k D:113-276 [128045] automatically matched to 2B7J A:111-282 complexed with pt |
PDB Entry: 2b7k (more details), 1.8 Å
SCOP Domain Sequences for d2b7kd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b7kd1 c.47.1.10 (D:113-276) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]} pslggpfhledmygnefteknllgkfsiiyfgfsncpdicpdeldklglwlntlsskygi tlqplfitcdpardspavlkeylsdfhpsilgltgtfdevknackkyrvyfstppnvkpg qdylvdhsiffylmdpegqfvdalgrnydektgvdkivehvksy
Timeline for d2b7kd1: