Lineage for d2b7kd1 (2b7k D:113-276)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 699806Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins)
  6. 700063Protein Thioredoxin-like protein Sco1 (YpmQ), soluble domain [102459] (3 species)
  7. 700068Species Baker's yeast(Saccharomyces cerevisiae) [TaxId:4932] [142372] (2 PDB entries)
  8. 700072Domain d2b7kd1: 2b7k D:113-276 [128045]
    automatically matched to 2B7J A:111-282
    complexed with pt

Details for d2b7kd1

PDB Entry: 2b7k (more details), 1.8 Å

PDB Description: Crystal Structure of Yeast Sco1
PDB Compounds: (D:) SCO1 protein

SCOP Domain Sequences for d2b7kd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b7kd1 c.47.1.10 (D:113-276) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]}
pslggpfhledmygnefteknllgkfsiiyfgfsncpdicpdeldklglwlntlsskygi
tlqplfitcdpardspavlkeylsdfhpsilgltgtfdevknackkyrvyfstppnvkpg
qdylvdhsiffylmdpegqfvdalgrnydektgvdkivehvksy

SCOP Domain Coordinates for d2b7kd1:

Click to download the PDB-style file with coordinates for d2b7kd1.
(The format of our PDB-style files is described here.)

Timeline for d2b7kd1: