Lineage for d2b7jc_ (2b7j C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877814Protein Thioredoxin-like protein Sco1 (YpmQ), soluble domain [102459] (3 species)
  7. 2877819Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [142372] (2 PDB entries)
    Uniprot P23833 111-262
  8. 2877826Domain d2b7jc_: 2b7j C: [128040]
    automated match to d2b7ja1
    complexed with cu

Details for d2b7jc_

PDB Entry: 2b7j (more details), 2.3 Å

PDB Description: Crystal Structure of Yeast Sco1 with Copper Bound
PDB Compounds: (C:) SCO1 protein

SCOPe Domain Sequences for d2b7jc_:

Sequence, based on SEQRES records: (download)

>d2b7jc_ c.47.1.10 (C:) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gkpslggpfhledmygnefteknllgkfsiiyfgfsncpdicpdeldklglwlntlssky
gitlqplfitcdpardspavlkeylsdfhpsilgltgtfdevknackkyrvyfstppnvk
pgqdylvdhsiffylmdpegqfvdalgrnydektgvdkivehvksyvpaeqr

Sequence, based on observed residues (ATOM records): (download)

>d2b7jc_ c.47.1.10 (C:) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gkpslggpfhledmygnefteknllgkfsiiyfgfsncpdicpdeldklglwlntlssky
gitlqplfitcdpardspavlkeylsdfhpsilgltgtfdevknackkyrvyvdhsiffy
lmdpegqfvdalgrnydektgvdkivehvksyvpaeqr

SCOPe Domain Coordinates for d2b7jc_:

Click to download the PDB-style file with coordinates for d2b7jc_.
(The format of our PDB-style files is described here.)

Timeline for d2b7jc_: