Lineage for d2b7ja1 (2b7j A:111-282)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877814Protein Thioredoxin-like protein Sco1 (YpmQ), soluble domain [102459] (3 species)
  7. 2877819Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [142372] (2 PDB entries)
    Uniprot P23833 111-262
  8. 2877824Domain d2b7ja1: 2b7j A:111-282 [128038]
    complexed with cu

Details for d2b7ja1

PDB Entry: 2b7j (more details), 2.3 Å

PDB Description: Crystal Structure of Yeast Sco1 with Copper Bound
PDB Compounds: (A:) SCO1 protein

SCOPe Domain Sequences for d2b7ja1:

Sequence, based on SEQRES records: (download)

>d2b7ja1 c.47.1.10 (A:111-282) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gkpslggpfhledmygnefteknllgkfsiiyfgfsncpdicpdeldklglwlntlssky
gitlqplfitcdpardspavlkeylsdfhpsilgltgtfdevknackkyrvyfstppnvk
pgqdylvdhsiffylmdpegqfvdalgrnydektgvdkivehvksyvpaeqr

Sequence, based on observed residues (ATOM records): (download)

>d2b7ja1 c.47.1.10 (A:111-282) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gkpslggpfhledmygnefteknllgkfsiiyfgfsncpdicpdeldklglwlntlssky
gitlqplfitcdpardspavlkeylsdfhpsilgltgtfdevknackkyrvyvdhsiffy
lmdpegqfvdalgrnydektgvdkivehvksyvpaeqr

SCOPe Domain Coordinates for d2b7ja1:

Click to download the PDB-style file with coordinates for d2b7ja1.
(The format of our PDB-style files is described here.)

Timeline for d2b7ja1: