SCOP 1.75: Domain d2b7hc1: 2b7h C:1-141

Lineage for d2b7hc1 (2b7h C:1-141)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (20 species)

7. Species Maned wolf (Chrysocyon brachyurus) [TaxId:68728] [63440] (2 PDB entries)

8. Domain d2b7hc1: 2b7h C:1-141 [128037]
   automatically matched to d1fhja_
   complexed with hem, so4

Details for d2b7hc1

PDB Entry: 2b7h, 2.2 Å

PDB Description: Hemoglobin from Cerdocyon thous, a canidae from Brazil, at 2.2 Angstroms resolution

PDB Compounds: (C:) hemoglobin alpha chain

SCOP Domain Sequences for d2b7hc1:

Sequence; same for both SEQRES and ATOM records:

>d2b7hc1 a.1.1.2 (C:1-141) Hemoglobin, alpha-chain {Maned wolf (Chrysocyon brachyurus) [TaxId: 68728]}
vlspadktnikstwdkigghagdyggealdrtfqsfpttktyfphfdlspgsaqvkahgk
kvadalttavahlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpteftpa
vhasldkfftavstvltskyr

Timeline for d2b7hc1:

• d2b7hc1 first appeared in SCOP 1.73
  
• d2b7hc1 is called d2b7hc_ in SCOPe 2.01
  
• d2b7hc1 appears in the current release, SCOPe 2.08, called d2b7hc_