Lineage for d2b7hc1 (2b7h C:1-141)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 631855Protein Hemoglobin, alpha-chain [46486] (19 species)
  7. 632288Species Maned wolf (Chrysocyon brachyurus) [TaxId:68728] [63440] (2 PDB entries)
  8. 632292Domain d2b7hc1: 2b7h C:1-141 [128037]
    automatically matched to d1fhja_
    complexed with hem, so4

Details for d2b7hc1

PDB Entry: 2b7h (more details), 2.2 Å

PDB Description: Hemoglobin from Cerdocyon thous, a canidae from Brazil, at 2.2 Angstroms resolution
PDB Compounds: (C:) hemoglobin alpha chain

SCOP Domain Sequences for d2b7hc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b7hc1 a.1.1.2 (C:1-141) Hemoglobin, alpha-chain {Maned wolf (Chrysocyon brachyurus) [TaxId: 68728]}
vlspadktnikstwdkigghagdyggealdrtfqsfpttktyfphfdlspgsaqvkahgk
kvadalttavahlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpteftpa
vhasldkfftavstvltskyr

SCOP Domain Coordinates for d2b7hc1:

Click to download the PDB-style file with coordinates for d2b7hc1.
(The format of our PDB-style files is described here.)

Timeline for d2b7hc1: