SCOPe 2.03: Domain d2b7ha_: 2b7h A:

Lineage for d2b7ha_ (2b7h A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (23 species)

7. Species Dusicyon thous [TaxId:9620] [186966] (1 PDB entry)

8. Domain d2b7ha_: 2b7h A: [128036]
   Other proteins in same PDB: d2b7hd_
   automated match to d1fhja_
   complexed with hem, so4

Details for d2b7ha_

PDB Entry: 2b7h, 2.2 Å

PDB Description: Hemoglobin from Cerdocyon thous, a canidae from Brazil, at 2.2 Angstroms resolution

PDB Compounds: (A:) hemoglobin alpha chain

SCOPe Domain Sequences for d2b7ha_:

Sequence; same for both SEQRES and ATOM records:

>d2b7ha_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Dusicyon thous [TaxId: 9620]}
vlspadktnikstwdkigghagdyggealdrtfqsfpttktyfphfdlspgsaqvkahgk
kvadalttavahlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpteftpa
vhasldkfftavstvltskyr

Timeline for d2b7ha_:

• d2b7ha_ first appeared in SCOP 1.73, called d2b7ha1
  
• d2b7ha_ appears in SCOPe 2.02
  
• d2b7ha_ appears in SCOPe 2.04
  
• d2b7ha_ appears in the current release, SCOPe 2.08