Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (23 species) |
Species Dusicyon thous [TaxId:9620] [186966] (1 PDB entry) |
Domain d2b7ha_: 2b7h A: [128036] Other proteins in same PDB: d2b7hd_ automated match to d1fhja_ complexed with hem, so4 |
PDB Entry: 2b7h (more details), 2.2 Å
SCOPe Domain Sequences for d2b7ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b7ha_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Dusicyon thous [TaxId: 9620]} vlspadktnikstwdkigghagdyggealdrtfqsfpttktyfphfdlspgsaqvkahgk kvadalttavahlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpteftpa vhasldkfftavstvltskyr
Timeline for d2b7ha_: