Lineage for d2b7ca2 (2b7c A:335-441)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2793864Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793865Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2793866Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins)
  6. 2793867Protein Elongation factor eEF-1alpha, C-terminal domain [50472] (2 species)
    eukaryotic and archaeal homologue of EF-Tu
  7. 2793868Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50473] (6 PDB entries)
  8. 2793869Domain d2b7ca2: 2b7c A:335-441 [128031]
    Other proteins in same PDB: d2b7ca1, d2b7ca3, d2b7cb_
    automated match to d1f60a2
    mutant

Details for d2b7ca2

PDB Entry: 2b7c (more details), 1.8 Å

PDB Description: yeast guanine nucleotide exchange factor eef1balpha k205a mutant in complex with eef1a
PDB Compounds: (A:) Elongation factor 1-alpha

SCOPe Domain Sequences for d2b7ca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b7ca2 b.44.1.1 (A:335-441) Elongation factor eEF-1alpha, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
casfnatvivlnhpgqisagyspvldchtahiacrfdellekndrrsgkkledhpkflks
gdaalvkfvpskpmcveafseypplgrfavrdmrqtvavgviksvdk

SCOPe Domain Coordinates for d2b7ca2:

Click to download the PDB-style file with coordinates for d2b7ca2.
(The format of our PDB-style files is described here.)

Timeline for d2b7ca2:

View in 3D
Domains from other chains:
(mouse over for more information)
d2b7cb_