![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) ![]() probably related to the second domain and its superfamiy by a circular permutation |
![]() | Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins) |
![]() | Protein Elongation factor eEF-1alpha, C-terminal domain [50472] (2 species) eukaryotic and archaeal homologue of EF-Tu |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50473] (6 PDB entries) |
![]() | Domain d2b7ca2: 2b7c A:335-441 [128031] Other proteins in same PDB: d2b7ca1, d2b7ca3, d2b7cb_ automated match to d1f60a2 mutant |
PDB Entry: 2b7c (more details), 1.8 Å
SCOPe Domain Sequences for d2b7ca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b7ca2 b.44.1.1 (A:335-441) Elongation factor eEF-1alpha, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} casfnatvivlnhpgqisagyspvldchtahiacrfdellekndrrsgkkledhpkflks gdaalvkfvpskpmcveafseypplgrfavrdmrqtvavgviksvdk
Timeline for d2b7ca2: