SCOPe 2.08: Domain d2b7ca1: 2b7c A:241-334

Lineage for d2b7ca1 (2b7c A:241-334)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.1: Elongation factors [50448] (11 proteins)

6. Protein Elongation factor eEF-1alpha, domain 2 [50454] (2 species)
   eukaryotic and archaeal homologue of EF-Tu

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50455] (6 PDB entries)

8. Domain d2b7ca1: 2b7c A:241-334 [128030]
   Other proteins in same PDB: d2b7ca2, d2b7ca3, d2b7cb_
   automated match to d1f60a1
   mutant

Details for d2b7ca1

PDB Entry: 2b7c, 1.8 Å

PDB Description: yeast guanine nucleotide exchange factor eef1balpha k205a mutant in complex with eef1a

PDB Compounds: (A:) Elongation factor 1-alpha

SCOPe Domain Sequences for d2b7ca1:

Sequence; same for both SEQRES and ATOM records:

>d2b7ca1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dkplrlplqdvykiggigtvpvgrvetgvikpgmvvtfapagvttevksvemhheqleqg
vpgdnvgfnvknvsvkeirrgnvcgdakndppkg

Timeline for d2b7ca1:

• d2b7ca1 first appeared in SCOP 1.73
  
• d2b7ca1 appears in SCOPe 2.07