![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
![]() | Family b.43.3.1: Elongation factors [50448] (11 proteins) |
![]() | Protein Elongation factor eEF-1alpha, domain 2 [50454] (2 species) eukaryotic and archaeal homologue of EF-Tu |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50455] (6 PDB entries) |
![]() | Domain d2b7ca1: 2b7c A:241-334 [128030] Other proteins in same PDB: d2b7ca2, d2b7ca3, d2b7cb_ automated match to d1f60a1 mutant |
PDB Entry: 2b7c (more details), 1.8 Å
SCOPe Domain Sequences for d2b7ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b7ca1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} dkplrlplqdvykiggigtvpvgrvetgvikpgmvvtfapagvttevksvemhheqleqg vpgdnvgfnvknvsvkeirrgnvcgdakndppkg
Timeline for d2b7ca1: