Lineage for d2b7ba3 (2b7b A:2-240)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695634Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 695845Protein Elongation factor eEF-1alpha, N-terminal (G) domain [52631] (2 species)
    eukaryotic and archaeal homologue of EF-Tu
  7. 695851Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52632] (6 PDB entries)
  8. 695856Domain d2b7ba3: 2b7b A:2-240 [128029]
    Other proteins in same PDB: d2b7ba1, d2b7ba2
    automatically matched to d1f60a3
    complexed with gdp; mutant

Details for d2b7ba3

PDB Entry: 2b7b (more details), 2.6 Å

PDB Description: Yeast guanine nucleotide exchange factor eEF1Balpha K205A mutant in complex with eEF1A and GDP
PDB Compounds: (A:) Elongation factor 1-alpha

SCOP Domain Sequences for d2b7ba3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b7ba3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gkekshinvvvighvdsgkstttghliykcggidkrtiekfekeaaelgkgsfkyawvld
klkaerergitidialwkfetpkyqvtvidapghrdfiknmitgtsqadcailiiaggvg
efeagiskdgqtrehallaftlgvrqlivavnkmdsvkwdesrfqeivketsnfikkvgy
npktvpfvpisgwngdnmieattnapwykgweketkagvvkgktlleaidaieqpsrpt

SCOP Domain Coordinates for d2b7ba3:

Click to download the PDB-style file with coordinates for d2b7ba3.
(The format of our PDB-style files is described here.)

Timeline for d2b7ba3: