SCOPe 2.08: Domain d2b7ba3: 2b7b A:2-240

Lineage for d2b7ba3 (2b7b A:2-240)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Elongation factor eEF-1alpha, N-terminal (G) domain [52631] (2 species)
   eukaryotic and archaeal homologue of EF-Tu

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52632] (6 PDB entries)

8. Domain d2b7ba3: 2b7b A:2-240 [128029]
   Other proteins in same PDB: d2b7ba1, d2b7ba2, d2b7bb1
   automated match to d1f60a3
   complexed with gdp; mutant

Details for d2b7ba3

PDB Entry: 2b7b, 2.6 Å

PDB Description: yeast guanine nucleotide exchange factor eef1balpha k205a mutant in complex with eef1a and gdp

PDB Compounds: (A:) Elongation factor 1-alpha

SCOPe Domain Sequences for d2b7ba3:

Sequence; same for both SEQRES and ATOM records:

>d2b7ba3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gkekshinvvvighvdsgkstttghliykcggidkrtiekfekeaaelgkgsfkyawvld
klkaerergitidialwkfetpkyqvtvidapghrdfiknmitgtsqadcailiiaggvg
efeagiskdgqtrehallaftlgvrqlivavnkmdsvkwdesrfqeivketsnfikkvgy
npktvpfvpisgwngdnmieattnapwykgweketkagvvkgktlleaidaieqpsrpt

Timeline for d2b7ba3:

• d2b7ba3 first appeared in SCOP 1.73
  
• d2b7ba3 appears in SCOPe 2.07