Lineage for d2b7ba1 (2b7b A:241-334)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2062589Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2062651Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2062652Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 2062682Protein Elongation factor eEF-1alpha, domain 2 [50454] (2 species)
    eukaryotic and archaeal homologue of EF-Tu
  7. 2062683Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50455] (6 PDB entries)
  8. 2062688Domain d2b7ba1: 2b7b A:241-334 [128027]
    Other proteins in same PDB: d2b7ba2, d2b7ba3, d2b7bb1
    automated match to d1f60a1
    complexed with gdp; mutant

Details for d2b7ba1

PDB Entry: 2b7b (more details), 2.6 Å

PDB Description: yeast guanine nucleotide exchange factor eef1balpha k205a mutant in complex with eef1a and gdp
PDB Compounds: (A:) Elongation factor 1-alpha

SCOPe Domain Sequences for d2b7ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b7ba1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dkplrlplqdvykiggigtvpvgrvetgvikpgmvvtfapagvttevksvemhheqleqg
vpgdnvgfnvknvsvkeirrgnvcgdakndppkg

SCOPe Domain Coordinates for d2b7ba1:

Click to download the PDB-style file with coordinates for d2b7ba1.
(The format of our PDB-style files is described here.)

Timeline for d2b7ba1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2b7bb1