SCOP 1.75: Domain d2b77b1: 2b77 B:10-123

Lineage for d2b77b1 (2b77 B:10-123)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (1 family)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (1 protein)

6. Protein Transthyretin (synonym: prealbumin) [49474] (4 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (79 PDB entries)
   Uniprot P02766 31-143

8. Domain d2b77b1: 2b77 B:10-123 [128024]
   automatically matched to d1bzda_
   complexed with 3ca

Details for d2b77b1

PDB Entry: 2b77, 1.7 Å

PDB Description: human transthyretin (ttr) complexed with diflunisal analogues- ttr.2', 4'-dichloro-4-hydroxy-1,1'-biphenyl-3-carboxylic acid

PDB Compounds: (B:) Transthyretin

SCOP Domain Sequences for d2b77b1:

Sequence, based on SEQRES records:

>d2b77b1 b.3.4.1 (B:10-123) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvt

Sequence, based on observed residues (ATOM records):

>d2b77b1 b.3.4.1 (B:10-123) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgrytiaallspysysttavvt

Timeline for d2b77b1:

• d2b77b1 first appeared in SCOP 1.73
  
• d2b77b1 is called d2b77b_ in SCOPe 2.01
  
• d2b77b1 appears in the current release, SCOPe 2.08, called d2b77b_