Lineage for d2b77b1 (2b77 B:10-123)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 659818Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 659956Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (1 family) (S)
  5. 659957Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (1 protein)
  6. 659958Protein Transthyretin (synonym: prealbumin) [49474] (4 species)
    sandwich; 8 strands in 2 sheets
  7. 659979Species Human (Homo sapiens) [TaxId:9606] [49475] (67 PDB entries)
  8. 660029Domain d2b77b1: 2b77 B:10-123 [128024]
    automatically matched to d1bzda_
    complexed with 3ca

Details for d2b77b1

PDB Entry: 2b77 (more details), 1.7 Å

PDB Description: human transthyretin (ttr) complexed with diflunisal analogues- ttr.2', 4'-dichloro-4-hydroxy-1,1'-biphenyl-3-carboxylic acid
PDB Compounds: (B:) Transthyretin

SCOP Domain Sequences for d2b77b1:

Sequence, based on SEQRES records: (download)

>d2b77b1 b.3.4.1 (B:10-123) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvt

Sequence, based on observed residues (ATOM records): (download)

>d2b77b1 b.3.4.1 (B:10-123) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgrytiaallspysysttavvt

SCOP Domain Coordinates for d2b77b1:

Click to download the PDB-style file with coordinates for d2b77b1.
(The format of our PDB-style files is described here.)

Timeline for d2b77b1: