SCOPe 2.05: Domain d2b76p1: 2b76 P:0-118

Lineage for d2b76p1 (2b76 P:0-118)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families)
   two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains

5. Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins)
   consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups

6. Protein Fumarate reductase subunit FrdD [81372] (2 species)

7. Species Escherichia coli [TaxId:562] [81371] (6 PDB entries)
   is not known to bind heme

8. Domain d2b76p1: 2b76 P:0-118 [128022]
   Other proteins in same PDB: d2b76a1, d2b76a2, d2b76a3, d2b76b1, d2b76b2, d2b76c1, d2b76m1, d2b76m2, d2b76m3, d2b76n1, d2b76n2, d2b76o1
   automatically matched to d1kf6d_
   complexed with f3s, fad, fes, flc, mq7, sf4; mutant

Details for d2b76p1

PDB Entry: 2b76, 3.3 Å

PDB Description: e. coli quinol fumarate reductase frda e49q mutation

PDB Compounds: (P:) Fumarate reductase subunit D

SCOPe Domain Sequences for d2b76p1:

Sequence; same for both SEQRES and ATOM records:

>d2b76p1 f.21.2.2 (P:0-118) Fumarate reductase subunit FrdD {Escherichia coli [TaxId: 562]}
minpnpkrsdepvfwglfgaggmwsaiiapvmillvgillplglfpgdalsyervlafaq
sfigrvflflmivlplwcglhrmhhamhdlkihvpagkwvfyglaailtvvtligvvti

Timeline for d2b76p1:

• d2b76p1 first appeared in SCOP 1.73
  
• d2b76p1 appears in SCOPe 2.04
  
• d2b76p1 appears in SCOPe 2.06
  
• d2b76p1 appears in the current release, SCOPe 2.08