Lineage for d2b76c1 (2b76 C:1-130)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745424Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 745476Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 745488Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (4 proteins)
    consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups
  6. 745489Protein Fumarate reductase subunit FrdC [81370] (1 species)
  7. 745490Species Escherichia coli [TaxId:562] [81369] (4 PDB entries)
    is not known to bind heme
  8. 745497Domain d2b76c1: 2b76 C:1-130 [128014]
    Other proteins in same PDB: d2b76a1, d2b76a2, d2b76a3, d2b76b1, d2b76b2, d2b76d1, d2b76m1, d2b76m2, d2b76m3, d2b76n1, d2b76n2, d2b76p1
    automatically matched to d1kf6c_
    complexed with f3s, fad, fes, flc, mq7, sf4; mutant

Details for d2b76c1

PDB Entry: 2b76 (more details), 3.3 Å

PDB Description: e. coli quinol fumarate reductase frda e49q mutation
PDB Compounds: (C:) Fumarate reductase subunit C

SCOP Domain Sequences for d2b76c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b76c1 f.21.2.2 (C:1-130) Fumarate reductase subunit FrdC {Escherichia coli [TaxId: 562]}
ttkrkpyvrpmtstwwkklpfyrfymlregtavpavwfsielifglfalkngpeawagfv
dflqnpviviinlitlaaallhtktwfelapkaaniivkdekmgpepiikslwavtvvat
ivilfvalyw

SCOP Domain Coordinates for d2b76c1:

Click to download the PDB-style file with coordinates for d2b76c1.
(The format of our PDB-style files is described here.)

Timeline for d2b76c1: