Lineage for d2b76a3 (2b76 A:226-357)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737821Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 737822Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 737823Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 737862Protein Fumarate reductase [56429] (2 species)
  7. 737863Species Escherichia coli [TaxId:562] [56430] (4 PDB entries)
  8. 737870Domain d2b76a3: 2b76 A:226-357 [128011]
    Other proteins in same PDB: d2b76a1, d2b76a2, d2b76b1, d2b76b2, d2b76c1, d2b76d1, d2b76m1, d2b76m2, d2b76n1, d2b76n2, d2b76o1, d2b76p1
    automatically matched to d1kf6a3
    complexed with f3s, fad, fes, flc, mq7, sf4; mutant

Details for d2b76a3

PDB Entry: 2b76 (more details), 3.3 Å

PDB Description: e. coli quinol fumarate reductase frda e49q mutation
PDB Compounds: (A:) Fumarate reductase flavoprotein subunit

SCOP Domain Sequences for d2b76a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b76a3 d.168.1.1 (A:226-357) Fumarate reductase {Escherichia coli [TaxId: 562]}
mefvqyhptglpgsgilmtegcrgeggilvnkngyrylqdygmgpetplgepknkymelg
prdkvsqafwhewrkgntistprgdvvyldlrhlgekklherlpficelakayvgvdpvk
epipvrptahyt

SCOP Domain Coordinates for d2b76a3:

Click to download the PDB-style file with coordinates for d2b76a3.
(The format of our PDB-style files is described here.)

Timeline for d2b76a3: