| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily) unusual fold |
Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) ![]() |
| Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins) |
| Protein Fumarate reductase [56429] (2 species) |
| Species Escherichia coli [TaxId:562] [56430] (4 PDB entries) |
| Domain d2b76a3: 2b76 A:226-357 [128011] Other proteins in same PDB: d2b76a1, d2b76a2, d2b76b1, d2b76b2, d2b76c1, d2b76d1, d2b76m1, d2b76m2, d2b76n1, d2b76n2, d2b76o1, d2b76p1 automatically matched to d1kf6a3 complexed with f3s, fad, fes, flc, mq7, sf4; mutant |
PDB Entry: 2b76 (more details), 3.3 Å
SCOP Domain Sequences for d2b76a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b76a3 d.168.1.1 (A:226-357) Fumarate reductase {Escherichia coli [TaxId: 562]}
mefvqyhptglpgsgilmtegcrgeggilvnkngyrylqdygmgpetplgepknkymelg
prdkvsqafwhewrkgntistprgdvvyldlrhlgekklherlpficelakayvgvdpvk
epipvrptahyt
Timeline for d2b76a3: