![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) ![]() |
![]() | Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins) |
![]() | Protein Fumarate reductase [46981] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [46982] (5 PDB entries) |
![]() | Domain d2b76a1: 2b76 A:443-576 [128009] Other proteins in same PDB: d2b76a2, d2b76a3, d2b76b1, d2b76b2, d2b76c1, d2b76d1, d2b76m2, d2b76m3, d2b76n1, d2b76n2, d2b76o1, d2b76p1 automatically matched to d1kf6a1 complexed with f3s, fad, fes, flc, mq7, sf4; mutant |
PDB Entry: 2b76 (more details), 3.3 Å
SCOPe Domain Sequences for d2b76a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b76a1 a.7.3.1 (A:443-576) Fumarate reductase {Escherichia coli [TaxId: 562]} dggenwakirdemglameegcgiyrtpelmqktidklaelqerfkrvritdtssvfntdl lytielghglnvaecmahsamarkesrgahqrldegcterddvnflkhtlafrdadgttr leysdvkittlppa
Timeline for d2b76a1: