Lineage for d2b76a1 (2b76 A:443-576)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 636659Fold a.7: Spectrin repeat-like [46965] (15 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 636710Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 636711Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)
  6. 636718Protein Fumarate reductase [46981] (2 species)
  7. 636719Species Escherichia coli [TaxId:562] [46982] (4 PDB entries)
  8. 636726Domain d2b76a1: 2b76 A:443-576 [128009]
    Other proteins in same PDB: d2b76a2, d2b76a3, d2b76b1, d2b76b2, d2b76c1, d2b76d1, d2b76m2, d2b76m3, d2b76n1, d2b76n2, d2b76o1, d2b76p1
    automatically matched to d1kf6a1
    complexed with f3s, fad, fes, flc, mq7, sf4; mutant

Details for d2b76a1

PDB Entry: 2b76 (more details), 3.3 Å

PDB Description: e. coli quinol fumarate reductase frda e49q mutation
PDB Compounds: (A:) Fumarate reductase flavoprotein subunit

SCOP Domain Sequences for d2b76a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b76a1 a.7.3.1 (A:443-576) Fumarate reductase {Escherichia coli [TaxId: 562]}
dggenwakirdemglameegcgiyrtpelmqktidklaelqerfkrvritdtssvfntdl
lytielghglnvaecmahsamarkesrgahqrldegcterddvnflkhtlafrdadgttr
leysdvkittlppa

SCOP Domain Coordinates for d2b76a1:

Click to download the PDB-style file with coordinates for d2b76a1.
(The format of our PDB-style files is described here.)

Timeline for d2b76a1: