![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
![]() | Superfamily b.62.1: Cyclophilin-like [50891] (5 families) ![]() |
![]() | Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
![]() | Protein Cyclophilin-like protein PY00693 [141507] (1 species) |
![]() | Species Plasmodium yoelii [TaxId:5861] [141508] (1 PDB entry) Uniprot Q7RRM6 29-197 |
![]() | Domain d2b71a1: 2b71 A:23-191 [128004] complexed with cl |
PDB Entry: 2b71 (more details), 2.5 Å
SCOPe Domain Sequences for d2b71a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} leekiayykmkghtergyitiytnlgdfevelywyhspktclnfytlcemgfydntifhr vipnfviqggdptgtgkggksiygeyfedeinkelkhtgagilsmsnngpntnssqffit laplphldgkhtifarvsknmtcieniasvqttatnkpifdlkilrtst
Timeline for d2b71a1: