![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
![]() | Family d.2.1.3: Phage lysozyme [53981] (4 proteins) |
![]() | Protein Phage T4 lysozyme [53982] (1 species) |
![]() | Species Bacteriophage T4 [TaxId:10665] [53983] (595 PDB entries) Uniprot P00720 many mutant structures |
![]() | Domain d2b70a_: 2b70 A: [128003] automated match to d181l__ complexed with bme, cl; mutant |
PDB Entry: 2b70 (more details), 2.4 Å
SCOPe Domain Sequences for d2b70a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b70a_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]} mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk deaeklfnqdvdaavrgilrnaklkpvydsldavrraaainmvfqmgetgvagftnslrm lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk
Timeline for d2b70a_: