![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.19: Aquaporin-like [81339] (1 superfamily) core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices |
![]() | Superfamily f.19.1: Aquaporin-like [81338] (2 families) ![]() |
![]() | Family f.19.1.1: Aquaporin-like [56895] (5 proteins) duplication: consist of two similar structural parts automatically mapped to Pfam PF00230 |
![]() | Protein Aquaporin-0 [103468] (2 species) |
![]() | Species Sheep (Ovis aries) [TaxId:9940] [103469] (2 PDB entries) |
![]() | Domain d2b6oa_: 2b6o A: [127997] complexed with mc3 |
PDB Entry: 2b6o (more details), 1.9 Å
SCOPe Domain Sequences for d2b6oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b6oa_ f.19.1.1 (A:) Aquaporin-0 {Sheep (Ovis aries) [TaxId: 9940]} rsasfwraifaeffatlfyvffglgaslrwapgplhvlqvalafglalatlvqavghisg ahvnpavtfaflvgsqmsllraicyvvaqllgavagaavlysvtppavrgnlalntlhpg vsvgqativeifltlqfvlcifatyderrngrlgsvalavgfsltlghlfgmyytgagmn parsfapailtrnftnhwvywvgpvigaglgsllydfllfprlksvserlsilkg
Timeline for d2b6oa_: